PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G234600.2.p
Common NameGLYMA_04G234600, LOC102670540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 219aa    MW: 25089.9 Da    PI: 8.803
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G234600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK75.85.1e-24110157552
               RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +++++++k+F  pi++AAk L+v+lT+LKr+CR++++kRWPhRk+ksl
  Glyma.04G234600.2.p 110 LKFDEIRKHFGVPITEAAKRLNVGLTMLKRRCRELNVKRWPHRKLKSL 157
                          899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.76895178IPR003035RWP-RK domain
PfamPF020425.6E-22110157IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MEISPLEGFS ELDWPYSSNH LCFNEFPDLE NLDLDFSLPP LGEYLEEELD QKPLNIVVSQ  60
GVHCNREKGF GEASSFTIEN GSATASYVQN IIRQRPQPVS SSSKKKTCVL KFDEIRKHFG  120
VPITEAAKRL NVGLTMLKRR CRELNVKRWP HRKLKSLQLL IDNVKEMGLE DEVARVEKHK  180
RLLEKLPGME LSEEAKKLRQ ACFKANYKKR RCMASLQA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1883706e-59AC188370.9 Glycine max cultivar PI 96983 clone gmp1-120k16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578896.11e-161PREDICTED: protein RKD4-like isoform X1
RefseqXP_006578897.11e-161PREDICTED: protein RKD4-like isoform X2
TrEMBLA0A0R0KGN31e-161A0A0R0KGN3_SOYBN; Uncharacterized protein
TrEMBLK7KLW81e-161K7KLW8_SOYBN; Uncharacterized protein
STRINGGLYMA04G41320.21e-161(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-39RWP-RK domain-containing protein